Pay in installments of $6.01 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 17 - Jul 22
For Your Every Summer RSVP, with Code: SUMMER15
Description
Hers and Hims Online GLP 1 Clinic Review How to Use Glo 1 Patches Use It TikTok how to get glp 1 covered by insurance reddit Everyone's on GLP 1s. But at What compound pharmacy baton rouge semaglutide Compounded Semaglutide, 3 month bundle Gentle Patches GLP 1 Review: Innovation or Illusion? GLP 1(7 36), amide107444 51 9HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR NH
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.2 ★★★★★
Based on 20 reviews
Sort
Product Reviews
★★★★★ 5
Cane Corso approved....
Size: Large, Pattern Name: Pack of 1
My Cane Corso loves this ball!!! She carries it around in her mouth like a round pacifier.
Sometimes I'll wake up with the ball next to my head on my pillow. Lol
This is the third one I've bought.
She doesn't destroy them at all . Somehow she loses them. Yesterday she had two floating around. Lol.
Earlier I gave her one of those hard rubber balls with feet... She destroyed it within minutes. She can skin a tennis ball and chew it in half in about 5 minutes.
This ball is by far a favorite toy of her's. And she doesn't chew it to bits .
And it glows in the dark which is fun for playing fetch at night.
It's very easy to clean.
Sometimes I put little snacks inside for her while she's laying down with her ball.
I will definitely keep buying these balls everytime we lose one . They make her happy. And that makes me happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
★★★★★ 5
BEST GLOW BALL! MY COLLIE BLUE HEELER MIX IS OBSESSED
Size: Large, Pattern Name: Pack of 1
Well if I could just say...Mommas a fan too....BUT I think my dog should be the sponsor of CHUCKIT because he owns everything and he BREATHES, DREAMS, RUNS with #chuckit balls!! Since 8wks. old & Now 10 yrs young, BDAY=8.10.26....he wakes up with it in his mouth and falls asleep with IT! I HAVE THEEEE PROOF LOL SERIOUSLY OBSESSED! #chuckit #makemydogyoursponsor WE HAVE EVERY BALL X10 FOR SOME, launchers, bucket o balls , you name it so yeah #obssesedisanunderstatement #bordercollieblueheelermix #HARLEY ♡ nice colors and the durability is amazing 👏 know if you have a chewer I'm not sure because he just likes to catch the ball and then chew it sometimes and then leave it alone, until next time around. But the GLOW BALL just being cewed for so long and the textire is obviously different so it does end up cracking and you throw it away, definitely different rubber but highly recommend them both actually ALL of them👌🎉🥳🫶🏼 my Sisters 2 yr old pit destroyed them in minutes but only FOR PLAY , so IF YOU DONT WANT THAT BALL chewed to pcs. Put it up LOL and oh
all of the balls EXCEPT the GLOW BALL stay true to form and durability, for real Harleys had some of them for years!! And nothing wrong with the CHUCKIT ball 10☆☆☆☆☆☆☆☆☆☆ SIZE is perfect too he love the medium 2.5" ball. Perfect for catching for hrs on end. You also have a choice you can get squeaky, crunchy,or nothing or glow in the dark, 3 sizes to fit your pupper..
.. so many choices and it doesn't have to be a ball you can pick from a ton of toys ' tuggers ,launchers and indoor toys too. As for the Chew resistance...mm touchy...like I said. Aggressive chewer are more likely to tear it up way quicker than the just playing mainly like I want to fetch dog. Either way. I dont purchase any other brand besides chuck it. Has always my pick, like 20+ yrs now lol. Hands down. This is not a paid thing or promoted or whatever. Just felt i should review for chuck it♡ to date has made my dog happy and healthier for years to come♡ thanks
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
★★★★★ 4
These are great!
Size: Medium, Pattern Name: Pack of 2
My dog loves these and now won't play fetch with any other ball. I love that they glow bright so we can play fetch after I get home from work (it gets dark around 5 now). The dog and I both like that they whistle. They also squish easily and he loves to chomp on them while he runs around. Only reason I took off a star is because he chewed a piece of it off and now it doesn't whistle or fly as far. That being said, it seems to stand up well to all the chomping he does on it. I should not have left him alone with it, I think he held it down and pulled on it. If your dog usually makes it his mission to destroy things I wouldn't leave him alone with it, other than that I absolutely recommend these.
Update 12/12/20: I got another dog last year and he also loves these balls. Probably the favorite ball for both dogs, they go into hyperdrive when they see them. New dog tends to be more destructive than the older one and I still don't leave them unattended with these balls, but new dog has not destroyed one. I made the mistake of leaving one in the Chuckit overnight once. Ball was wet from playing in the snow and became lopsided. Now doesn't fly very well but my weird dog still likes it. It is also starting to dry out and crack. None of the other glow balls have done this, I'm assuming it is also from leaving it in the Chuckit overnight.
Other than that, these balls are great. I did read a few reviews that said charging them with UV light made them stay brighter for a longer period, but I did not notice a difference in my quick test of this theory. Just keep a good flashlight with you and brighten them up as needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 6, 2018
★★★★★ 5
Good for night sessions
Size: Medium, Pattern Name: Pack of 1
Picked this up for evening fetch sessions and it’s been a win. It charges up fast, couple minutes under a lamp or in sunlight and it’s good to go, and the glow is genuinely bright, not the sad dim purple some of these put out. Makes it way easier to find in the yard at dusk, and the dog can actually track it.
It’s a little on the softer side compared to a regular tennis ball, but durable enough to hold up to my big dog, who is not gentle with toys. Still kicking after plenty of chomping and slobber. Fits a standard Chuckit! launcher perfectly, which is the whole point.
Pros:
• Glows brightly and clearly in the dark
• Charges fast from any light source
• Holds up well even with a big, enthusiastic chewer
• Fits standard ball-throwing sticks
• Great for evening or early-morning fetch
Cons:
• A bit softer than a regular tennis ball — a determined power-chewer could probably destroy it eventually
• Glow fades after a while, so you’ll need to recharge it during long sessions
• Only glows if it’s been charged, which is obvious but easy to forget
Tips:
• Charge it under a bright light or in the sun for a few minutes before heading out
• A flashlight works in a pinch if you forgot to charge it
• Keep it out of permanent fetch duty — rotate with a regular ball so it lasts longer
• Not a chew toy, even though it’s tempting to leave it with the dog
Five stars. If you’ve got a dog and a yard, this makes evening fetch actually doable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
★★★★★ 5
Westies Fav
Size: Small, Pattern Name: Pack of 1
Best Westie ball ever, my dog loves this ball. Exactly her size! 3" tennis balls are too big & she rips the fur off. this silicone-ish ball has no fur & is 2&1/2 "
We have 2" balls from her electronic ball laucher, but she still loves this glow in the dark best!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
recommand products
GLP-1 Patches: What They Are and What You Should Know
21.20
glp 1 eyesight Do GLP-1 Medications Cause Eye Problems? Understanding the NAION Risk – Revolution Health & Wellness-150cent
23.11
Vision changes on ozempic? #ozempic #glp #visionloss #neuroophthalmology #explorepages
25.22
Popular Type 2 Diabetes Drug Associated with Increased Risk of NAION
26.35
The Impact of GLP-1 Receptor Agonists on Ocular Disease
23.72